ArtNr |
CSB-EP872532HU-1 |
Hersteller |
Cusabio
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Konjugat/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
SMAD ubiquitination regulatory factor 2SMAD-specific E3 ubiquitin-protein ligase 2 |
Lieferbar |
|
Research Areas |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q9HAU4 |
Gene Names |
SMURF2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDP FAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIG KSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAIN RLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD RIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQY LNHITRTTQWERPTRPASEYSSPGRPLSCFVDENT PISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRT HLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWH DPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYF VDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQ QVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQ QQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYG LFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIM GMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELV DPDLHNSLVWILENDITGVLDHTFCVEHNAYGEII QHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIE AQFLALQKGFNEVIPQHLLKTFDEKELELIICGLG KIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDE ERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTI HQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKL LTAIEETCGFAVE |
Expression Region |
1-748aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
113.2 kDa |
Alternative Name(s) |
SMAD ubiquitination regulatory factor 2SMAD-specific E3 ubiquitin-protein ligase 2 |
Relevance |
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD1 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with SCYE1. Forms a stable complex with the TGF-beta receptor-mediated phosphorylated SMAD2 and SMAD3. In this way, SMAD2 may recruit substrates, such as SNON, for ubiquitin-mediated degradation. Enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level. |
Reference |
Smad7 binds to Smurf2 to form an E3 ubiquitin ligase that targets the TGF-beta receptor for degradation.Kavsak P., Rasmussen R.K., Causing C.G., Bonni S., Zhu H., Thomsen G.H., Wrana J.L.Mol. Cell 6:1365-1375(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD1 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with SCYE1. Forms a stable complex with the TGF-beta receptor-mediated phosphorylated SMAD2 and SMAD3. In this way, SMAD2 may recruit substrates, such as SNON, for ubiquitin-mediated degradation. Enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level. |
Subcellular Location |
Nucleus, Cytoplasm, Cell membrane, Membrane raft |
Tissue Specificity |
Widely expressed. |
Paythway |
Hedgehogsignalingpathway |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.