« Zurück
Home /
Recombinant Human Thioredoxin-like protein 4B(TXNL4B)

Recombinant Human Thioredoxin-like protein 4B(TXNL4B)

ArtNr	CSB-EP868342HU-10
Hersteller	Cusabio
Menge	10ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Dim1-like protein
Lieferbar
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	Q9NX01
Gene Names	TXNL4B
Organism	Homo sapiens (Human)
AA Sequence	MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDED PVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYT QYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGS FKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIP KYDLLYQDI
Expression Region	1-149aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	44 kDa
Alternative Name(s)	Dim1-like protein
Relevance	Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G2 transition.
Reference	"DLP, a novel Dim1 family protein implicated in pre-mRNA splicing and cell cycle progression." Sun X., Zhang H., Wang D., Ma D., Shen Y., Shang Y. J. Biol. Chem. 279:32839-32847(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.
Subcellular Location	Nucleus
Protein Families	DIM1 family
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen