« Zurück
Home /
Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1(GABARAPL1)

Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1(GABARAPL1)

ArtNr	CSB-EP861986HU-200
Hersteller	Cusabio
Menge	200ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Early estrogen-regulated protein,GABA(A) receptor-associated protein-like 1,Glandular epithelial cell protein 1
Lieferbar
Research Topic	Neuroscience
Uniprot ID	Q9H0R8
Gene Names	GABARAPL1
Organism	Homo sapiens (Human)
AA Sequence	MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEK APKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHL RPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFL YVAYSDESVYG
Expression Region	1-117aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	40.9 kDa
Alternative Name(s)	Early estrogen-regulated protein GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1
Relevance	Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Reference	"A novel early estrogen-regulated gene gec1 encodes a protein related to GABARAP." Vernier-Magnin S., Muller S., Sallot M., Radom J., Musard J.-F., Adami P., Dulieu P., Remy-Martin J.-P., Jouvenot M., Fraichard A. Biochem. Biophys. Res. Commun. 284:118-125(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Subcellular Location	Cytoplasm, cytoskeleton, Cytoplasmic vesicle membrane, Lipid-anchor, Endoplasmic reticulum, Golgi apparatus, Cytoplasmic vesicle, autophagosome
Protein Families	ATG8 family
Tissue Specificity	Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta.
Paythway	Autophagy-animal
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen