« Zurück
Home /
Recombinant Naja kaouthia Cobra venom factor,partial

Recombinant Naja kaouthia Cobra venom factor,partial

ArtNr	CSB-EP856221NAFe0-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Others
Uniprot ID	Q91132
Gene Names	N/A
Organism	Naja kaouthia (Monocled cobra) (Naja siamensis)
AA Sequence	DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPN SQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICV AEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILH NYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPI KALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSD GVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQL EVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENS IDGSKLN
Expression Region	733-984aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	55.4 kDa
Alternative Name(s)	Complement C3 homolog
Relevance	Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI). Therefore, CVF continuously activates complement resulting in the depletion of complement activity.
Reference	"Molecular cloning and derived primary structure of cobra venom factor."Fritzinger D.C., Bredehorst R., Vogel C.-W.Proc. Natl. Acad. Sci. U.S.A. 91:12775-12779(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI). Therefore, CVF continuously activates complement resulting in the depletion of complement activity.
Subcellular Location	Secreted
Protein Families	Venom complement C3 homolog family
Tissue Specificity	Expressed by the venom gland.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen