« Zurück
Home /
Recombinant Human WD repeat domain phosphoinositide-interacting protein 4(WDR45)

Recombinant Human WD repeat domain phosphoinositide-interacting protein 4(WDR45)

ArtNr	CSB-EP852773HU-200
Hersteller	Cusabio
Menge	200ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	WD repeat-containing protein 45
Lieferbar
Research Topic	Cell Biology
Uniprot ID	Q9Y484
Gene Names	WDR45
Organism	Homo sapiens (Human)
AA Sequence	MTQQPLRGVTSLRFNQDQSCFCCAMETGVRIYNVE PLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGS SPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPV LSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDT RDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLA STKPGTSSAPFTINAHQSDIACVSLNQPGTVVASA SQKGTLIRLFDTQSKEKLVELRRGTDPATLYCINF SHDSSFLCASSDKGTVHIFALKDTRLNRRSALARV GKVGPMIGQYVDSQWSLASFTVPAESACICAFGRN TSKNVNSVIAICVDGTFHKYVFTPDGNCNREAFDV YLDICDDDDF
Expression Region	1-360aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	66.9 kDa
Alternative Name(s)	WD repeat-containing protein 45
Relevance	Plays an important role in the autophagy pathway, which is the major intracellular degradation system by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation.
Reference	"WIPI-1alpha (WIPI49), a member of the novel 7-bladed WIPI protein family, is aberrantly expressed in human cancer and is linked to starvation-induced autophagy." Proikas-Cezanne T., Waddell S., Gaugel A., Frickey T., Lupas A., Nordheim A. Oncogene 23:9314-9325(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays an important role in the autophagy pathway, which is the major intracellular degradation system by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation.
Involvement in disease	Neurodegeneration with brain iron accumulation 5 (NBIA5)
Protein Families	WD repeat SVP1 family
Tissue Specificity	Ubiquitously expressed, with high expression in skeletal muscle and heart. Weakly expressed in liver and placenta. Expression is down-regulated in pancreatic and in kidney tumors.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen