« Zurück
Home /
Recombinant Macaca fascicularis IgG receptor FcRn large subunit p51(FCGRT),partial

Recombinant Macaca fascicularis IgG receptor FcRn large subunit p51(FCGRT),partial

ArtNr	CSB-EP851443MOV-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
Lieferbar
Research Topic	Others
Uniprot ID	Q8SPV9
Gene Names	FCGRT
Organism	Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
AA Sequence	AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQY LSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRI KEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSV PTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQR WQQQDKAANKELTFLLFSCPHRLREHLERGRGNLE WKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQL RFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSG DEHHYCCIVQHAGLAQPLRVELETPAKSS
Expression Region	24-297aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	46.4 kDa
Alternative Name(s)	IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
Relevance	Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus .
Reference	Binding of human IgG to cynomolgus FcR.Namenuk A.K., Hong K., Meng Y.G., Shields R.L., Cromwell M.E.M., Presta L.G.
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity). Possible role in transfer of immunoglobulin G from mother to fetus (By similarity).
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Protein Families	Immunoglobulin superfamily
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen