ArtNr |
CSB-EP842166HU-50 |
Hersteller |
Cusabio
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Konjugat/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Topic |
Cell Biology |
Uniprot ID |
Q92890 |
Gene Names |
UFD1L |
Organism |
Homo sapiens (Human) |
AA Sequence |
MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPN DRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLT NKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLE EGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKA VLENALRNFACLTTGDVIAINYNEKIYELRVMETK PDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST EGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPS PSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKK VEEDEAGGRFVAFSGEGQSLRKKGRKP |
Expression Region |
1-307aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
61.5 kDa |
Relevance |
Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures. |
Reference |
"UFD1L, a developmentally expressed ubiquitination gene, is deleted in CATCH 22 syndrome." Pizzuti A., Novelli G., Ratti A., Amati F., Mari A., Calabrese G., Nicolis S., Silani V., Marino B., Scarlato G., Ottolenghi S., Dallapiccola B. Hum. Mol. Genet. 6:259-265(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures (By similarity). Acts as a negative regulator of type I interferon production via the complex formed with VCP and NPLOC4, which binds to DDX58/RIG-I and recruits RNF125 to promote ubiquitination and degradation of DDX58/RIG-I |
Subcellular Location |
Nucleus, Cytoplasm, cytosol |
Protein Families |
UFD1 family |
Tissue Specificity |
Found in adult heart, skeletal muscle and pancreas, and in fetal liver and kidney. |
Paythway |
Proteinprocessinginendoplasmicreticulum |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.