« Zurück
Home /
Recombinant Chicken Interferon type B(IFNB)

Recombinant Chicken Interferon type B(IFNB)

ArtNr	CSB-EP838568CH-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Others
Target / Protein	IFNB
Biologically active	Not Test
Expression system	E.coli
Species of origin	Gallus gallus (Chicken)
Uniprot ID	Q90873
AA Sequence	CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDV TFPFPETLLKSKDKKQAAITTLRILQHLFNMLSSP HTPKHWIDRTRHSLLNQIQHYIHHLEQCFVNQGTR SQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWD HVRLQARDCFRHVDTLIQWMKSRAPLTASSKRLNT
Tag Info	N-terminal 6xHis-tagged
Expression Region	28-203aa
Protein length	Full Length of Mature Protein
MW	24.8 kDa
Alternative Name(s)	IFN2
Relevance	Has antiviral activities.
References	"A family of genes coding for two serologically distinct chicken interferons." Sick C., Schultz U., Staeheli P. J. Biol. Chem. 271:7635-7639(1996)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has antiviral activities.
Subcellular Location	Secreted
Protein Families	Alpha/beta interferon family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen