« Zurück
Home /
Recombinant Human Nectin-2(PVRL2),partial

Recombinant Human Nectin-2(PVRL2),partial

ArtNr	CSB-EP835690HU-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Herpes virus entry mediator B,Short name:,Herpesvirus entry mediator B,Short name:,HveB,Nectin cell adhesion molecule 2,Poliovirus receptor-related protein 2,CD_antigen: CD112
Lieferbar
Research Areas	Immunology
Uniprot ID	Q92692
Gene Names	PVRL2
Organism	Homo sapiens (Human)
AA Sequence	QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYIS LVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSE RLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEG NYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKV TFSQDPTTVALCISKEGRPPARISWLSSLDWEAKE TQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVE HESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGR TDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQG SQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFV RETPNTAGAGATGG
Expression Region	32-360aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	39.2 kDa
Alternative Name(s)	Herpes virus entry mediator B Short name: Herpesvirus entry mediator B Short name: HveB Nectin cell adhesion molecule 2 Poliovirus receptor-related protein 2 CD_antigen: CD112
Relevance	Probable cell adhesion protein.
Reference	A cell surface protein with herpesvirus entry activity (HveB) confers susceptibility to infection by mutants of herpes simplex virus type 1, herpes simplex virus type 2, and pseudorabies virus.Warner M.S., Geraghty R.J., Martinez W.M., Montgomery R.I., Whitbeck J.C., Xu R., Eisenberg R.J., Cohen G.H., Spear P.G.Virology 246:179-189(1998).
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Protein Families	Nectin family
Tissue Specificity	Ubiquitous.
Paythway	Adherensjunction
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen