ArtNr |
CSB-EP835690HU-1 |
Hersteller |
Cusabio
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Herpes virus entry mediator B,Short name:,Herpesvirus entry mediator B,Short name:,HveB,Nectin cell adhesion molecule 2,Poliovirus receptor-related protein 2,CD_antigen: CD112 |
Lieferbar |
|
Research Areas |
Immunology |
Uniprot ID |
Q92692 |
Gene Names |
PVRL2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYIS LVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSE RLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEG NYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKV TFSQDPTTVALCISKEGRPPARISWLSSLDWEAKE TQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVE HESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGR TDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQG SQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFV RETPNTAGAGATGG |
Expression Region |
32-360aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
39.2 kDa |
Alternative Name(s) |
Herpes virus entry mediator B Short name: Herpesvirus entry mediator B Short name: HveB Nectin cell adhesion molecule 2 Poliovirus receptor-related protein 2 CD_antigen: CD112 |
Relevance |
Probable cell adhesion protein. |
Reference |
A cell surface protein with herpesvirus entry activity (HveB) confers susceptibility to infection by mutants of herpes simplex virus type 1, herpes simplex virus type 2, and pseudorabies virus.Warner M.S., Geraghty R.J., Martinez W.M., Montgomery R.I., Whitbeck J.C., Xu R., Eisenberg R.J., Cohen G.H., Spear P.G.Virology 246:179-189(1998). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive |
Subcellular Location |
Cell membrane, Single-pass type I membrane protein |
Protein Families |
Nectin family |
Tissue Specificity |
Ubiquitous. |
Paythway |
Adherensjunction |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.