« Zurück
Home /
Recombinant Human Tomoregulin-1(TMEFF1),partial

Recombinant Human Tomoregulin-1(TMEFF1),partial

ArtNr	CSB-EP818263HUa0-500
Hersteller	Cusabio
Menge	500ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Others
Target / Protein	TMEFF1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	Q8IYR6
AA Sequence	SNQPPGGGGGSGGDCPGGKGKSINCSELNVRESDV RVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIP VCGSNGDTYQNECFLRRAACKHQKEITVIARGPCY SDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAEC DEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPC FVREASCIKQEQIDIRHLGHCTDTDDTSLLGKKDD GLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCI HGKCEFIYSTQKASCRCESGYTGQHCEKTDFSILY VVPSRQKLTHV
Tag Info	N-terminal 6xHis-tagged
Expression Region	40-330aa
Protein length	Partial
MW	35.5 kDa
Alternative Name(s)	H7365 Transmembrane protein with EGF-like and one follistatin-like domain C9orf2
Relevance	May inhibit NODAL and BMP signaling during neural patterning. May be a tumor suppressor in brain cancers.
References	"A novel transmembrane protein with epidermal growth factor and follistatin domains expressed in the hypothalamo-hypophysial axis of Xenopus laevis." Eib D.W., Martens G.J.M. J. Neurochem. 67:1047-1055(1996)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May inhibit NODAL and BMP signaling during neural patterning (By similarity). May be a tumor suppressor in brain cancers.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Protein Families	Tomoregulin family
Tissue Specificity	Expressed predominantly in brain, and at lower levels in heart, placenta and skeletal muscle. Down-regulated in brain tumors as compared to control brain tissues.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen