« Zurück
Home /
Recombinant Pan troglodytes Lymphotoxin-beta(LTB),partial

Recombinant Pan troglodytes Lymphotoxin-beta(LTB),partial

ArtNr	CSB-EP771253EQV-500
Hersteller	Cusabio
Menge	500ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3
Lieferbar
Research Topic	Others
Uniprot ID	Q862Z7
Gene Names	LTB
Organism	Pan troglodytes (Chimpanzee)
AA Sequence	QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDL SPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQ FSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQ GRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPV LDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNI SHPDMVDFARGKTFFGAVMVG
Expression Region	49-244aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	24.8 kDa
Alternative Name(s)	Tumor necrosis factor C ; TNF-CTumor necrosis factor ligand superfamily member 3
Relevance	Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the mbrane anchor for the attachment of the heterotrimeric complex to the cell surface .
Reference	Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M., Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K., Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A. , Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T., Inoko H., Bahram S.Genetics 173:1555-1570(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface (By similarity).
Subcellular Location	Membrane, Single-pass type II membrane protein
Protein Families	Tumor necrosis factor family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen