« Zurück
Home /
Recombinant Mouse Complement component receptor 1-like protein(Cr1l),partial

Recombinant Mouse Complement component receptor 1-like protein(Cr1l),partial

ArtNr	CSB-EP717575MO1-50
Hersteller	Cusabio
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Others
Target / Protein	Cr1l
Biologically active	Not Test
Expression system	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	Q64735
AA Sequence	ELRGGLGKHGHTVHREPAVNRLCADSKRWSGLPVS AQRPFPMGHCPAPSQLPSAKPINLTDESMFPIGTY LLYECLPGYIKRQFSITCKQDSTWTSAEDKCIRKQ CKTPSDPENGLVHVHTGIQFGSRINYTCNQGYRLI GSSSAVCVITDQSVDWDTEAPICEWIPCEIPPGIP NGDFFSSTREDFHYGMVVTYRCNTDARGKALFNLV GEPSLYCTSNDGEIGVWSGPPPQCIELNKCTPPPY VENAVMLSENRSLFSLRDIVEFRCHPGFIMKGASS VHCQSLNKWEPELPSCFKGVICRLPQEMSGFQKGL GMKKEYYYGENVTLECEDGYTLEGSSQSQCQSDGS WNPLLAKCVSRSISG
Tag Info	N-terminal 6xHis-tagged
Expression Region	41-405aa
Protein length	Partial
MW	44.5 kDa
Alternative Name(s)	Complement regulatory protein Crry Protein p65
Relevance	Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. Also acts as a decay-accelerating factor, preventing the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Plays a crucial role in early embryonic development by maintaining fetomaternal tolerance. Also acts as a costimulatory factor for T-cells which favors IL-4 secretion.
References	"The murine complement receptor gene family: III. The genomic and transcriptional complexity of the Crry and Crry-ps genes." Paul M.S., Aegerter-Shaw M., Cepek K., Miller M.D., Weis J.H. J. Immunol. 144:1988-1996(1990)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. Also acts as a decay-accelerating factor, preventing the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Plays a crucial role in early embryonic development by maintaining fetomaternal tolerance. Also acts as a costimulatory factor for T-cells which favors IL-4 secretion.
Subcellular Location	Membrane, Single-pass type I membrane protein
Protein Families	Receptors of complement activation (RCA) family
Tissue Specificity	Ubiquitously expressed (at protein level).
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen