ArtNr |
CSB-EP717575MO1-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research areas |
Others |
Target / Protein |
Cr1l |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
Q64735 |
AA Sequence |
ELRGGLGKHGHTVHREPAVNRLCADSKRWSGLPVS AQRPFPMGHCPAPSQLPSAKPINLTDESMFPIGTY LLYECLPGYIKRQFSITCKQDSTWTSAEDKCIRKQ CKTPSDPENGLVHVHTGIQFGSRINYTCNQGYRLI GSSSAVCVITDQSVDWDTEAPICEWIPCEIPPGIP NGDFFSSTREDFHYGMVVTYRCNTDARGKALFNLV GEPSLYCTSNDGEIGVWSGPPPQCIELNKCTPPPY VENAVMLSENRSLFSLRDIVEFRCHPGFIMKGASS VHCQSLNKWEPELPSCFKGVICRLPQEMSGFQKGL GMKKEYYYGENVTLECEDGYTLEGSSQSQCQSDGS WNPLLAKCVSRSISG |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
41-405aa |
Protein length |
Partial |
MW |
44.5 kDa |
Alternative Name(s) |
Complement regulatory protein Crry Protein p65 |
Relevance |
Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. Also acts as a decay-accelerating factor, preventing the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Plays a crucial role in early embryonic development by maintaining fetomaternal tolerance. Also acts as a costimulatory factor for T-cells which favors IL-4 secretion. |
References |
"The murine complement receptor gene family: III. The genomic and transcriptional complexity of the Crry and Crry-ps genes." Paul M.S., Aegerter-Shaw M., Cepek K., Miller M.D., Weis J.H. J. Immunol. 144:1988-1996(1990) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. Also acts as a decay-accelerating factor, preventing the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Plays a crucial role in early embryonic development by maintaining fetomaternal tolerance. Also acts as a costimulatory factor for T-cells which favors IL-4 secretion. |
Subcellular Location |
Membrane, Single-pass type I membrane protein |
Protein Families |
Receptors of complement activation (RCA) family |
Tissue Specificity |
Ubiquitously expressed (at protein level). |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.