ArtNr |
CSB-EP717229MO-1 |
Hersteller |
Cusabio
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:,MAdCAM-1,Short name:,mMAdCAM-1 |
Lieferbar |
|
Research Areas |
Immunology |
Uniprot ID |
Q61826 |
Gene Names |
Madcam1 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
QSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARV HWRGLDTSLGSVQTLPGSSILSVRGMLSDTGTPVC VGSCGSRSFQHSVKILVYAFPDQLVVSPEFLVPGQ DQVVSCTAHNIWPADPNSLSFALLLGEQRLEGAQA LEPEQEEEIQEAEGTPLFRMTQRWRLPSLGTPAPP ALHCQVTMQLPKLVLTHRKEIPVLQSQTSPKPPNT TSAEPYILTSSSTAEAVSTGLNITTLPSAPPYPKL SPRTLSSEGPCRPKIHQDLEAGWELLCEASCGPGV TVRWTLAPGDLATYHKREAGAQAWLSVLPPGPMVE GWFQCRQDPGGEVTNLYVPGQVTPNSSS |
Expression Region |
22-364aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
52.8 kDa |
Alternative Name(s) |
Short name: MAdCAM-1 Short name: mMAdCAM-1 |
Relevance |
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Both isoform 1 and isoform 2 can adhere to integrin alpha-4/beta-7. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding. |
Reference |
MAdCAM-1 has homology to immunoglobulin and mucin-like adhesion receptors and to IgA1.Briskin M.J., McEvoy L.M., Butcher E.C.Nature 363:461-464(1993) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Both isoform 1 and isoform 2 can adhere to integrin alpha-4/beta-7. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding. |
Involvement in disease |
Absence of Madcam1 in the spleen has been found in aly/aly mice, but normal expression is found in intestinal venules. This aberrant expression is a secondary defect and not the direct cause of aly alymphoplasia, an autosomal recessive mutation which induces total aplasia of lymph nodes and Peyer patches. |
Subcellular Location |
Membrane, Single-pass type I membrane protein |
Tissue Specificity |
Highly expressed on high endothelial venules (HEV) of organized intestinal lymphoid tissues like the Peyer patches and mesenteric lymph nodes, and in the lamina propria of the intestine. Some expression found in the spleen, and low levels of expression in the peripheral lymph nodes and the lactating mammary gland. No expression was detected in the liver, kidneys, lungs or in normal brain. Expressed as well in brain endothelioma cells, and mucosal tissues which are in a chronic state of inflammation, such as inflammed pancreas. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.