« Zurück
Home /
Recombinant Arabidopsis thaliana Histone deacetylase HDT2(HDT2)

Recombinant Arabidopsis thaliana Histone deacetylase HDT2(HDT2)

ArtNr	CSB-EP684969DOA-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HD-tuins protein 2,Histone deacetylase 2b
Lieferbar
Research Topic	Others
Uniprot ID	Q56WH4
Gene Names	HDT2
Organism	Arabidopsis thaliana (Mouse-ear cress)
AA Sequence	MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTV KSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLV FDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSD DEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKA KPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKG MDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKR PNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGG HTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNK KPFNSGKQFGGSNNKGSNKGKGKGRA
Expression Region	1-306aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	37.3 kDa
Alternative Name(s)	HD-tuins protein 2 Histone deacetylase 2b
Relevance	Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.
Reference	"Functional analysis of HD2 histone deacetylase homologues in Arabidopsis thaliana."Wu K., Tian L., Malik K., Brown D., Miki B.Plant J. 22:19-27(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.
Subcellular Location	Nucleus, nucleolus
Protein Families	Histone deacetylase HD2 family
Tissue Specificity	Expressed in leaves, roots, stems, young plantlets, flowers and siliques. Highest levels in ovules, embryos, shoot apical meristems and first leaves. Also expressed in somatic embryos.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen