« Zurück
Home /
Recombinant Macaca fascicularis Gamma-synuclein(SNCG)

Recombinant Macaca fascicularis Gamma-synuclein(SNCG)

ArtNr	CSB-EP646889MOV-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Neuroscience
Target / Protein	SNCG
Biologically active	Not Test
Expression system	E.coli
Species of origin	Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Uniprot ID	Q2PFW6
AA Sequence	MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKE GVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAV VSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAP QQEGEAAKEKEEVAEEAQSGGD
Tag Info	Tag-Free
Expression Region	1-127aa
Protein length	Full Length
MW	13.3 kDa
Relevance	Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway
References	"Analysis of gene expression in cynomolgus monkey tissues by macaque cDNA oligo-chips." Kobayashi M., Tanuma R., Hirata M., Osada N., Kusuda J., Sugano S., Hashimoto K. Submitted (JUL-2005)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity).
Subcellular Location	Cytoplasm, perinuclear region, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, spindle
Protein Families	Synuclein family
Tag Information	Tag-Free

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen