Vergleich

Recombinant Dog Epididymal secretory protein E1(NPC2)

ArtNr CSB-EP634688DOa2-500
Hersteller Cusabio
Menge 500ug
Quantity options 1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Purity Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Research Topic
Others
Uniprot ID
Q28895
Gene Names
NPC2
Organism
Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence
VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYS VNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEAD GCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVV QWMLLGDNNQHLFCWEIPVQIEG
Expression Region
22-149aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
30 kDa
Alternative Name(s)
Niemann Pick type C2 protein homolog
cE1
Relevance
Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting membrane of late endosomes/ lysosomes to the ER and plasma membrane by an unknown mechanism. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport
Reference
"Gene expression in the dog epididymis: a model for human epididymal function."Ellerbrock K., Pera I., Hartung S., Ivell R.Int. J. Androl. 17:314-323(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting membrane of late endosomes/ lysosomes to the ER and plasma membrane by an unknown mechanism. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport (By similarity).
Subcellular Location
Secreted, Endoplasmic reticulum, Lysosome
Protein Families
NPC2 family
Tissue Specificity
Epididymis. High levels are found in the caput and corpus regions. Weaker levels in the distal cauda and in the efferent ducts.
Tag Information
N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen