ArtNr |
CSB-EP618776HU-1 |
Hersteller |
Cusabio
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:,MAdCAM-1,Short name:,hMAdCAM-1 |
Lieferbar |
|
Research Areas |
Immunology |
Uniprot ID |
Q13477 |
Gene Names |
MADCAM1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACAD RGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSA AGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPA ALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQEL EGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPP LGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPT SPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPE PPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQA GPTQGEVIPTGSSKPAGDQ |
Expression Region |
19-317aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
47.4 kDa |
Alternative Name(s) |
Short name: MAdCAM-1 Short name: hMAdCAM-1 |
Relevance |
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding. |
Reference |
Cloning of the mucosal addressin MAdCAM-1 from human brain: identification of novel alternatively spliced transcripts.Leung E., Greene J., Ni J., Raymond L.G., Lehnert K., Langley R., Krissansen G.W.Immunol. Cell Biol. 74:490-496(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding. |
Subcellular Location |
Membrane, Single-pass type I membrane protein |
Tissue Specificity |
Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the thymus, prostate, ovaries, testis, heart, placenta, lung, liver, skeletal muscle, kidney or peripheral blood leukocytes. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.