« Zurück
Home /
Recombinant Staphylococcus aureus Enterotoxin type C-3(entC3)

Recombinant Staphylococcus aureus Enterotoxin type C-3(entC3)

ArtNr	CSB-EP357923FKZ-50
Hersteller	Cusabio
Menge	50ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SEC3
Lieferbar
Research Topic	Others
Uniprot ID	P0A0L5
Gene Names	entC3
Organism	Staphylococcus aureus
AA Sequence	ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSA TKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLN EDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVT GGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKR NTISFEVQTDKKSVTAQELDIKARNFLINKKNLYE FNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQ SKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Expression Region	28-266aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	43.6 kDa
Alternative Name(s)	SEC3
Relevance	Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Reference	Crystal structure of a T-cell receptor beta-chain complexed with a superantigen.Fields B.A., Malchiodi E.L., Li H., Ysern X., Stauffacher C.V., Schlievert P.M., Karjalainen K., Mariuzza R.A.Nature 384:188-192(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Subcellular Location	Secreted
Protein Families	Staphylococcal/streptococcal toxin family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP357923FKZ-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen