ArtNr |
CSB-EP357862SKY-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
H-gamma-1,H-gamma-I |
Lieferbar |
|
Research areas |
others |
Target / Protein |
hlgB |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Staphylococcus aureus (strain N315) |
Uniprot ID |
P0A075 |
AA Sequence |
AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQ ILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPN DYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQ NEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFS ETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNN GWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIA QHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVT YQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYE IDWENHKVKLLDTKETENNK |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
26-325aa |
Protein length |
Full Length of Mature Protein |
MW |
38.1 kDa |
Alternative Name(s) |
H-gamma-1 H-gamma-I |
Relevance |
Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity |
References |
"Shotgun proteomic analysis of total and membrane protein extracts of S. aureus strain N315." Vaezzadeh A.R., Deshusses J., Lescuyer P., Hochstrasser D.F. Submitted (OCT-2007) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity (By similarity). |
Protein Families |
Aerolysin family |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.