ArtNr |
CSB-EP356017MHK-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Core polyprotein,Cleaved into the following 4 chains:,Matrix protein p15,Short name:,MA,RNA-binding phosphoprotein p12,Alternative name(s):,pp12,Capsid protein p30,Short name:,CA,Nucleocapsid protein p10,Short name:,NC-gag |
Lieferbar |
|
Research Topic |
Microbiology |
Uniprot ID |
P03332 |
Gene Names |
gag |
Organism |
Moloney murine leukemia virus (isolate Shinnick) (MoMLV) |
AA Sequence |
PLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPG KLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQR VLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWD YTTQAGRNHLVHYRQLLLAGLQNAGRSPTNLAKVK GITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQE TNVSMSFIWQSAPDIGRKLERLEDLKNKTLGDLVR EAEKIFNKRETPEEREERIRRETEEKEERRRTEDE QKEKERDRRRHREMSKLL |
Expression Region |
216-478aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
46.6 kDa |
Alternative Name(s) |
Core polyprotein Cleaved into the following 4 chains: Matrix protein p15 Short name: MA RNA-binding phosphoprotein p12 Alternative name(s): pp12 Capsid protein p30 Short name: CA Nucleocapsid protein p10 Short name: NC-gag |
Relevance |
Gag polyprotein plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably link the viral protein to the host ESCRT pathway and facilitate release. |
Reference |
"Late domain-independent rescue of a release-deficient Moloney murine leukemia virus by the ubiquitin ligase Itch."Jadwin J.A., Rudd V., Sette P., Challa S., Bouamr F.J. Virol. 84:704-715(2010) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Gag polyprotein |
Subcellular Location |
Gag polyprotein: Virion, Host cell membrane, Lipid-anchor, Host late endosome membrane, Lipid-anchor, Host endosome, host multivesicular body, Note=These locations are probably linked to virus assembly sites, SUBCELLULAR LOCATION: Matrix protein p15: Virion, SUBCELLULAR LOCATION: Capsid protein p30: Virion, SUBCELLULAR LOCATION: Nucleocapsid protein p10-Gag: Virion, SUBCELLULAR LOCATION: RNA-binding phosphoprotein p12: Host cytoplasm |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.