« Zurück
Home /
Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)

Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)

ArtNr	CSB-EP346834SVG-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer Breast Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Nicotine deamidase,Short name:,NAMase
Lieferbar
Research Areas	Microbiology
Uniprot ID	P53184
Gene Names	PNC1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence	MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDL MQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPY STYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLV DQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNF HKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISA AELGYKTTVLLDYTRPISDDPEVINKVKEELKAHN INVVDK
Expression Region	1-216aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	29 kDa
Alternative Name(s)	Nicotine deamidase Short name: NAMase
Relevance	Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
Reference	Identification and functional analysis of the Saccharomyces cerevisiae nicotinamidase gene, PNC1.Ghislain M., Talla E., Francois J.M.Yeast 19:215-224(2002).
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
Subcellular Location	Cytoplasm, Nucleus, Peroxisome
Protein Families	Isochorismatase family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen