« Zurück
Home /
Recombinant Glycine max Cell division cycle protein 48 homolog(CDC48),partial

Recombinant Glycine max Cell division cycle protein 48 homolog(CDC48),partial

ArtNr	CSB-EP346583GGV-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Food Safety Allergenes Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Valosin-containing protein homolog,Short name:,VCP
Lieferbar
Research Areas	Neuroscience
Uniprot ID	P54774
Gene Names	CDC48
Organism	Glycine max (Soybean) (Glycine hispida)
AA Sequence	DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFS GADITEICQRACKYAIRENIEKDIERERKSRENPE AMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADI RKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDP FAASAGGADEDDLYS
Expression Region	653-807aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	33.5 kDa
Alternative Name(s)	Valosin-containing protein homolog Short name: VCP
Relevance	Probably functions in cell division and growth processes.
Reference	Identification of cDNA clones encoding valosin-containing protein and other plant plasma membrane-associated proteins by a general immunoscreening strategy.Shi J., Dixon R.A., Gonzales R.A., Kjellbom P., Bhattacharyya M.K.Proc. Natl. Acad. Sci. U.S.A. 92:4457-4461(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Probably functions in cell division and growth processes.
Subcellular Location	Cell membrane, Peripheral membrane protein
Protein Families	AAA ATPase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP346583GGV-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen