« Zurück
Home /
Recombinant Escherichia coli RNA-splicing ligase RtcB(rtcB)

Recombinant Escherichia coli RNA-splicing ligase RtcB(rtcB)

ArtNr	CSB-EP341647ENV-10
Hersteller	Cusabio
Menge	10ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Cell Biology
Uniprot ID	P46850
Gene Names	rtcB
Organism	Escherichia coli (strain K12)
AA Sequence	MNYELLTTENAPVKMWTKGVPVEADARQQLINTAK MPFIFKHIAVMPDVHLGKGSTIGSVIPTKGAIIPA AVGVDIGCGMNALRTALTAEDLPENLAELRQAIET AVPHGRTTGRCKRDKGAWENPPVNVDAKWAELEAG YQWLTQKYPRFLNTNNYKHLGTLGTGNHFIEICLD ESDQVWIMLHSGSRGIGNAIGTYFIDLAQKEMQET LETLPSRDLAYFMEGTEYFDDYLKAVAWAQLFASL NRDAMMENVVTALQSITQKTVRQPQTLAMEEINCH HNYVQKEQHFGEEIYVTRKGAVSARAGQYGIIPGS MGAKSFIVRGLGNEESFCSCSHGAGRVMSRTKAKK LFSVEDQIRATAHVECRKDAEVIDEIPMAYKDIDA VMAAQSDLVEVIYTLRQVVCVKG
Expression Region	1-408aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	61.2 kDa
Relevance	RNA ligase that mediates the joining of broken tRNA-like stem-loop structures in case of tRNA damage. Probably participates to tRNA restriction-repair by ligating broken tRNA-like stem-loop structures with 2', 3'-cyclic phosphate and 5'-OH ends to form a splice junction with a 2'-OH, 3', 5'-phosphodiester, a step that requires GTP . Also acts as a DNA ligase in case of DNA damage by splicing 'dirty' DNA breaks, characterized by 3'-PO4 (or cyclic-PO4) and 5'-OH ends that cannot be sealed by classical DNA ligases
Reference	"Characterization of the Escherichia coli RNA 3'-terminal phosphate cyclase and its sigma54-regulated operon." Genschik P., Drabikowski K., Filipowicz W. J. Biol. Chem. 273:25516-25526(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	RNA ligase that mediates the joining of broken tRNA-like stem-loop structures in case of tRNA damage. Probably participates to tRNA restriction-repair by ligating broken tRNA-like stem-loop structures with 2', 3'-cyclic phosphate and 5'-OH ends to form a splice junction with a 2'-OH, 3', 5'-phosphodiester, a step that requires GTP
Protein Families	RtcB family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen