« Zurück
Home /
Recombinant Mouse Carboxylesterase 1C(Ces1c),partial

Recombinant Mouse Carboxylesterase 1C(Ces1c),partial

ArtNr	CSB-EP338557MOe1-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Oncology Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	others
Target / Protein	Ces1c
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	P23953
AA Sequence	HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGV PFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCS QDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYS PADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALS AHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLD QLAALRWVQDNIANFGGNPDSVTIFGESSGGISVS VLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAV NEIIATLSQCNDTSSAAMVQCLRQKTESELLEISG KLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVP YIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLL LRRFHSELNISESMIPAVIEQYLRGVDDPAKKSEL ILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRY RPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGAS EEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYD EQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPP ETDPTEH
Tag Info	Tag-Free
Expression Region	19-550aa
Protein Length	Partial
MW	58.6 kDa
Alternative Name(s)	Liver carboxylesterase N Lung surfactant convertase PES-N
Relevance	Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
Reference	Proteome-wide characterization of N-glycosylation events by diagonal chromatography. Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K. J. Proteome Res. 5:2438-2447(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
Subcellular Location	Endoplasmic reticulum lumen
Protein Families	Type-B carboxylesterase/lipase family
Tissue Specificity	Expressed in lung, kidney and liver.
Tag Information	Tag-Free

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen