ArtNr |
CSB-EP333055RJA-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Konjugat/Tag |
Myc |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research areas |
Others |
Target / Protein |
M |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Rabies virus (strain CVS-11) (RABV) |
Uniprot ID |
P25223 |
AA Sequence |
MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPP PEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFR ILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAP VPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQ EITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNS RACQLWSDMSLQTQRSEEDKDSSLLLE |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Expression Region |
1-202aa |
Protein length |
Full Length of Mature Protein |
MW |
28.1 kDa |
Alternative Name(s) |
Phosphoprotein M2 |
Relevance |
Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons |
References |
"Comparative sequence analysis of the M gene among rabies virus strains and its expression by recombinant vaccinia virus." Hiramatsu K., Mannen K., Mifune K., Nishizono A., Takita-Sonoda Y. Virus Genes 7:83-88(1993) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons (By similarity). |
Subcellular Location |
Virion membrane, Peripheral membrane protein, Host endomembrane system, Peripheral membrane protein |
Protein Families |
Lyssavirus matrix protein family |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.