« Zurück
Home /
Recombinant Hordeum vulgare Oxalate oxidase 1

Recombinant Hordeum vulgare Oxalate oxidase 1

ArtNr	CSB-EP332739HWQ-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Signal Transduction
Target / Protein	N/A
Biologically active	Not Test
Expression system	E.coli
Species of origin	Hordeum vulgare (Barley)
Uniprot ID	P45850
AA Sequence	SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDD FLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTL GVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELL VGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQF NVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIP TPVLTKALRVEAGVVELLKSKFAGGS
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	1-201aa
Protein length	Full Length
MW	28.2 kDa
Alternative Name(s)	Germin
Relevance	Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms.
References	"Germin is a manganese containing homohexamer with oxalate oxidase and superoxide dismutase activities." Woo E.-J., Dunwell J.M., Goodenough P.W., Marvier A.C., Pickersgill R.W. Nat. Struct. Biol. 7:1036-1040(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms.
Subcellular Location	Secreted, extracellular space, apoplast, Secreted, cell wall
Protein Families	Germin family
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen