« Zurück
Home /
Recombinant Clostridium butyricum Botulinum neurotoxin type E,partial

Recombinant Clostridium butyricum Botulinum neurotoxin type E,partial

ArtNr	CSB-EP327013DUK-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Others
Uniprot ID	P30995
Gene Names	N/A
Organism	Clostridium butyricum
AA Sequence	PTINSFNYNDPVNNRTILYIKPGGCQQFYKSFNIM KNIWIIPERNVIGTIPQDFLPPTSLKNGDSSYYDP NYLQSDQEKDKFLKIVTKIFNRINDNLSGRILLEE LSKANPYLGNDNTPDGDFIINDASAVPIQFSNGSQ SILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNH GFGSIAIVTFSPEYSFRFKDNSMNEFIQDPALTLM HELIHSLHGLYGAKGITTKYTITQKQNPLITNIRG TNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKK IASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGI YSVNINKFNDIFKKLYSFTEFDLATKFQVKCRQTY IGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRG QNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGI
Expression Region	2-422aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	63.7 kDa
Relevance	Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase.
Reference	Neurotoxin type E from Clostridium botulinum and C. butyricum; partial sequence and comparison.Gimenez J., Foley J., Dasgupta B.R.FASEB J. 2:A1750-A1750(1988)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase.
Subcellular Location	Botulinum neurotoxin E light chain: Secreted, Host cytoplasm, host cytosol, SUBCELLULAR LOCATION: Botulinum neurotoxin E heavy chain: Secreted, Host cell junction, host synapse, host presynaptic cell membrane
Protein Families	Peptidase M27 family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen