« Zurück
Home /
Recombinant Escherichia coli Metalloprotease LoiP(loiP)

Recombinant Escherichia coli Metalloprotease LoiP(loiP)

ArtNr	CSB-EP326582ENV-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Others
Target / Protein	loiP
Biologically active	Not Test
Expression system	E.coli
Species of origin	Escherichia coli (strain K12)
Uniprot ID	P25894
AA Sequence	CQNMDSNGLLSSGAEAFQAYSLSDAQVKTLSDQAC QEMDSKATIAPANSEYAKRLTTIANALGNNINGQP VNYKVYMAKDVNAFAMANGCIRVYSGLMDMMTDNE VEAVIGHEMGHVALGHVKKGMQVALGTNAVRVAAA SAGGIVGSLSQSQLGNLGEKLVNSQFSQRQEAEAD DYSYDLLRQRGISPAGLATSFEKLAKLEEGRQSSM FDDHPASAERAQHIRDRMSADGIK
Tag Info	N-terminal 6xHis-tagged
Expression Region	19-252aa
Protein length	Full Length of Mature Protein
MW	29.0 kDa
Alternative Name(s)	yggG
Relevance	Metalloprotease that cleaves substrates preferentially between Phe-Phe residues. Plays a role in response to some stress conditions. Seems to regulate the expression of speB.
References	"Influence of cyclic AMP, agmatine, and a novel protein encoded by a flanking gene on speB (agmatine ureohydrolase) in Escherichia coli." Szumanski M.B.W., Boyle S.M. J. Bacteriol. 174:758-764(1992)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Metalloprotease that cleaves substrates preferentially between Phe-Phe residues. Plays a role in response to some stress conditions. Seems to regulate the expression of speB.
Subcellular Location	Cell outer membrane, Lipid-anchor
Protein Families	Peptidase M48B family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen