Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
50ug |
Host |
E.coli |
ArtNr |
CSB-EP326235DBI-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Alias |
Short name:,MIT 1,Alternative name(s):,Black mamba intestinal toxin 1,Black mamba venom protein A |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Research Topic |
Others |
Uniprot ID |
P25687 |
Gene Names |
N/A |
Organism |
Dendroaspis polylepis polylepis (Black mamba) |
AA Sequence |
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVG TSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQT SPKKFKCLSKS |
Expression Region |
1-81aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
24.6 kDa |
Alternative Name(s) |
Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A |
Relevance |
Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel. |
Reference |
"MIT1, a black mamba toxin with a new and highly potent activity on intestinal contraction."Schweitz H., Pascaud P., Diochot S., Moinier D., Lazdunski M.FEBS Lett. 461:183-188(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2 |
Subcellular Location |
Secreted |
Protein Families |
AVIT (prokineticin) family |
Tissue Specificity |
Expressed by the venom gland. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.