« Zurück
Home /
Recombinant Ornithodoros moubata Tick anticoagulant peptide

Recombinant Ornithodoros moubata Tick anticoagulant peptide

ArtNr	CSB-EP325525OCK-50
Hersteller	Cusabio
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Others
Target / Protein	N/A
Biologically active	Not Test
Expression system	E.coli
Species of origin	Ornithodoros moubata (Soft tick) (Argasid tick)
Uniprot ID	P17726
AA Sequence	YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDS FWICPEDHTGADYYSSYRDCFNACI
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region	1-60aa
Protein length	Full Length
MW	27.0 kDa
Relevance	TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.
References	"NMR solution structure of the recombinant tick anticoagulant protein (rTAP), a factor Xa inhibitor from the tick Ornithodoros moubata." Antuch W., Guntert P., Billeter M., Hawthorne T., Grossenbacher H., Wuethrich K. FEBS Lett. 352:251-257(1994)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.
Tag Information	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen