ArtNr |
CSB-EP325525OCK-50 |
Hersteller |
Cusabio
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Konjugat/Tag |
Myc |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research areas |
Others |
Target / Protein |
N/A |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Ornithodoros moubata (Soft tick) (Argasid tick) |
Uniprot ID |
P17726 |
AA Sequence |
YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDS FWICPEDHTGADYYSSYRDCFNACI |
Tag Info |
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Expression Region |
1-60aa |
Protein length |
Full Length |
MW |
27.0 kDa |
Relevance |
TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa. |
References |
"NMR solution structure of the recombinant tick anticoagulant protein (rTAP), a factor Xa inhibitor from the tick Ornithodoros moubata." Antuch W., Guntert P., Billeter M., Hawthorne T., Grossenbacher H., Wuethrich K. FEBS Lett. 352:251-257(1994) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa. |
Tag Information |
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.