Vergleich

Recombinant Bovine Interferon tau-1(IFNT1)

ArtNr CSB-EP322795BO-1
Hersteller Cusabio
Menge 1mg
Quantity options 1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Cattle
Host E.coli
Purity Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Antiluteolysin;Trophoblast antiluteolytic protein;Trophoblast protein 1 ;TP-1Trophoblastin
Lieferbar
Research Areas
Others
Target / Protein
IFNT1
Biologically Active
Not Test
Expression System
E.coli
Species of origin
Bos taurus (Bovine)
Uniprot ID
P15696
AA Sequence
CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKD FGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYT EHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMG EKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCA WEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL
Tag Info
N-terminal 6xHis-tagged
Expression Region
24-195aa
Protein Length
Full Length of Mature Protein
MW
23.8 kDa
Alternative Name(s)
Antiluteolysin; Trophoblast antiluteolytic protein; Trophoblast protein 1 ; TP-1Trophoblastin
Relevance
Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This, and a possible direct effect of IFN-tau on prostaglandin synthesis, leads in turn to continued ovarian progesterone secretion, which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary, displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity, high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs, IFN-tau is not virally inducible.
Reference
Molecular cloning and characterization of complementary deoxyribonucleic acids corresponding to bovine trophoblast protein-1 a comparison with ovine trophoblast protein-1 and bovine interferon-alpha II.Imakawa K., Hansen T.R., Malathy P.-V., Anthony R.V., Polites H.G., Marotti K.R., Roberts R.M.Mol. Endocrinol. 3:127-139(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This, and a possible direct effect of IFN-tau on prostaglandin synthesis, leads in turn to continued ovarian progesterone secretion, which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary, displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity, high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs, IFN-tau is not virally inducible.
Subcellular Location
Secreted
Protein Families
Alpha/beta interferon family, IFN-alphaII subfamily
Tissue Specificity
Constitutively and exclusively expressed in the mononuclear cells of the extraembryonic trophectoderm.
Tag Information
N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen