ArtNr |
CSB-EP318492JAM-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Nucleocapsid protein,Protein N |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
P14239 |
Gene Names |
N |
Organism |
Junin mammarenavirus (JUNV) (Junn mammarenavirus) |
AA Sequence |
MAHSKEVPSFRWTQSLRRGLSQFTQTVKSDVLKDA KLIADSIDFNQVAQVQRALRKTKRGEEDLNKLRDL NKEVDRLMSMRSVQRNTVFKAGDLGRVERMELASG LGNLKTKFRRAETGSQGVYMGNLSQSQLAKRSEIL RTLGFQQQGTGGNGVVRVWDVKDPSKLNNQFGSVP ALTIACMTVQGGETMNSVIQALTSLGLLYTVKYPN LSDLDRLTQEHDCLQIVTKDESSINISGYNFSLSA AVKAGASILDDGNMLETIRVTPDNFSSLIKSTIQV KRREGMFIDEKPGNRNPYENLLYKLCLSGDGWPYI GSRSQIIGRSWDNTSIDLTRKPVAGPRQPEKNGQN LRLANLTEIQEAVIREAVGKLDPTNTLWLDIEGPA TDPVEMALFQPAGSKYIHCFRKPHDEKGFKNGSRH SHGILMKDIEDAMPGVLSYVIGLLPPDMVVTTQGS DDIRKLFDLHGRRDLKLVDVRLTSEQARQFDQQVW EKFGHLCKHHNGVVVSKKKRDKDAPFKLASSEPHC ALLDCIMFQSVLDGKLYEEELTPLLPPSLLFLPKA AYAL |
Expression Region |
1-564aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
79 kDa |
Alternative Name(s) |
Nucleocapsid protein Protein N |
Relevance |
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Disables the host innate defense by interfering with beta interferon (IFNB) production through the inhibition of host IRF3 phosphorylation and activation by host IKBKE. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of IRF3, a protein involved in IFN activation pathway, leading to the inhibition of IFNB and IRF3-dependent promoters activation (By similarity). Interacts with host IKBKE (via Protein kinase domain); the interaction inhibits IKBKE kinase activity. |
Reference |
"Molecular organization of Junin virus S RNA: complete nucleotide sequence, relationship with other members of the Arenaviridae and unusual secondary structures."Ghiringhelli P.D., Rivera-Pomar R.V., Lozano M.E., Grau O., Romanowski V.J. Gen. Virol. 72:2129-2141(1991) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Disables the host innate defense by interfering with beta interferon (IFNB) production through the inhibition of host IRF3 phosphorylation and activation by host IKBKE. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of IRF3, a protein involved in IFN activation pathway, leading to the inhibition of IFNB and IRF3-dependent promoters activation (By similarity). Interacts with host IKBKE (via Protein kinase domain); the interaction inhibits IKBKE kinase activity. |
Subcellular Location |
Virion, Host cytoplasm |
Protein Families |
Arenaviridae nucleocapsid protein family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.