Recombinant Conus striatus Con-ikot-ikot

Others

N/A

SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFC YQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLS GAHEACKTVSCGNPCA

Full Length of Mature Protein

N-terminal 6xHis-tagged

Potently and selectively blocks the desensitization of ionotropic glutamate AMPA receptor (GRIA1, GRIA2, GRIA3 and GRIA4). Can also open already desensitized GRIA1 receptors. Binds to a different site than does the drug cyclothiazide . The toxin acts like a straightjacket on the ligand-binding domain (LBD) "gating ring" of the receptor, restraining the domains via both intra- and interdimer cross-links such that agonist-induced closure of the LBD "clamshells" is transduced into an irislike expansion of the gating ring . Application of the toxin to hippocampal slices causes a large and rapid increase in resting AMPAR-mediated current leading to neuronal death .

Greater than 90% as determined by SDS-PAGE.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.

Potently and selectively blocks the desensitization of ionotropic glutamate AMPA receptor (GRIA1, GRIA2, GRIA3 and GRIA4). Can also open already desensitized GRIA1 receptors. Binds to a different site than does the drug cyclothiazide

Expressed by the venom duct.