« Zurück
Home /
Recombinant Escherichia coli Thioredoxin-2(trxC)

Recombinant Escherichia coli Thioredoxin-2(trxC)

ArtNr	CSB-EP314858ENV-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein-disulfide reductase
Lieferbar
Research Topic	Others
Uniprot ID	P0AGG4
Gene Names	trxC
Organism	Escherichia coli (strain K12)
AA Sequence	MNTVCTHCQAINRIPDDRIEDAAKCGRCGHDLFDG EVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNF APIFEDVAQERSGKVRFVKVNTEAERELSSRFGIR SIPTIMIFKNGQVVDMLNGAVPKAPFDSWLNESL
Expression Region	1-139aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	31.6 kDa
Alternative Name(s)	Protein-disulfide reductase
Relevance	Efficient electron donor for the essential enzyme ribonucleotide reductase. Is also able to reduce the interchain disulfide bridges of insulin.
Reference	Cloning, expression, and characterization of a novel Escherichia coli thioredoxin.Miranda-Vizuete A., Damdimopoulos A.E., Gustafsson J.-A., Spyrou G.J. Biol. Chem. 272:30841-30847(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Efficient electron donor for the essential enzyme ribonucleotide reductase. Is also able to reduce the interchain disulfide bridges of insulin.
Subcellular Location	Cytoplasm
Protein Families	Thioredoxin family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen