ArtNr |
CSB-EP304533TBF-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Konjugat/Tag |
Myc |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
TM-LCP A1A,Short name:,TM-A1A |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
P80681 |
Gene Names |
N/A |
Organism |
Tenebrio molitor (Yellow mealworm beetle) |
AA Sequence |
GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPI ARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPV AVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQV ESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFN AVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH |
Expression Region |
1-174aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged |
MW |
24.7 kDa |
Alternative Name(s) |
TM-LCP A1A Short name: TM-A1A |
Relevance |
Component of the cuticle of the larva of Tenebrio molitor |
Reference |
"Sequence studies of proteins from larval and pupal cuticle of the yellow meal worm, Tenebrio molitor."Andersen S.O., Rafn K., Roepstorff P.Insect Biochem. Mol. Biol. 27:121-131(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Component of the cuticle of the larva of Tenebrio molitor. |
Tag Information |
N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.