ArtNr |
CSB-EP303407MLW-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:,X-Pro aminopeptidase,Alternative name(s):,Aminoacylproline aminopeptidase,Aminopeptidase P,Short name:,APP |
Lieferbar |
|
Research Topic |
Microbiology |
Uniprot ID |
P75313 |
Gene Names |
pepP |
Organism |
Mycoplasma pneumoniae (strain ATCC 29342 / M129) |
AA Sequence |
MHNELQQKLAVLHKLLQDNKADAILIGSDQNRFWL TGFPSSAGWLVVHKQRVNLFIDGRYFEAAKTAIDP LVKVELFTTYKQVKALCEQVGVKHLLIEGDYLTFN YQNFIKELCAQYTVINAQEIRRQKLPSEILAIEKV VEITRKVAVKLKRFIQPGMTELFIAQWITDQLVKA GGAKNSFDPIVATGKNGANPHHKPSKLKVKSGDFV TCDFGTIYNGYCSDITRTFLVGKKPNNEVLLKAYK KVDEANMAGINAANTQLTGAEVDKVCRDIIEASEF KDYFVHSTGHGVGLDIHEMPNVSTSYNKLLCENAV ITIEPGIYIPSVGGIRIEDMVLVKDHKSVWLSAKI PRAF |
Expression Region |
1-354aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
55.6 kDa |
Alternative Name(s) |
Short name: X-Pro aminopeptidase Alternative name(s): Aminoacylproline aminopeptidase Aminopeptidase P Short name: APP |
Reference |
"Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996) . |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Protein Families |
Peptidase M24B family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.