« Zurück
Home /
Recombinant Escherichia coli Oxidoreductase YdhF(ydhF)

Recombinant Escherichia coli Oxidoreductase YdhF(ydhF)

ArtNr	CSB-EP300544ENV-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Others
Uniprot ID	P76187
Gene Names	ydhF
Organism	Escherichia coli (strain K12)
AA Sequence	MVQRITIAPQGPEFSRFVMGYWRLMDWNMSARQLV SFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALKL APHLRERMEIVSKCGIATTAREENVIGHYITDRDH IIKSAEQSLINLATDHLDLLLIHRPDPLMDADEVA DAFKHLHQSGKVRHFGVSNFTPAQFALLQSRLPFT LATNQVEISPVHQPLLLDGTLDQLQQLRVRPMAWS CLGGGRLFNDDYFQPLRDELAVVAEELNAGSIEQV VYAWVLRLPSQPLPIIGSGKIERVRAAVEAETLKM TRQQWFRIRKAALGYDVP
Expression Region	1-298aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	37.7 kDa
Relevance	May function as oxidoreductase.
Reference	"Structural genomics of highly conserved microbial genes of unknown function in search of new antibacterial targets." Abergel C., Coutard B., Byrne D., Chenivesse S., Claude J.-B., Deregnaucourt C., Fricaux T., Gianesini-Boutreux C., Jeudy S., Lebrun R., Maza C., Notredame C., Poirot O., Suhre K., Varagnol M., Claverie J.-M. J. Struct. Funct. Genomics 4:141-157(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function as oxidoreductase.
Protein Families	Aldo/keto reductase family, Aldo/keto reductase 2 subfamily
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen