ArtNr |
CSB-EP026909HU-100 |
Hersteller |
Cusabio
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Cutaneous T-cell lymphoma-associated antigen se33-1,Short name:CTCL-associated antigen se33-1,Nuclear protein 220,Zinc finger matrin-like protein |
Lieferbar |
|
Research Areas |
Others |
Uniprot ID |
Q14966 |
Gene Names |
ZNF638 |
Organism |
Homo sapiens (Human) |
AA Sequence |
TFATLNTKGNEGDTVRDSIGFISSQVPEDPSTLVT VDEIQDDSSDLHLVTLDEVTEEDEDSLADFNNLKE ELNFVTVDEVGEEEDGDNDLKVELAQSKNDHPTDK KGNRKKRAVDTKKTKLESLSQVGPVNENVMEEDLK TMIERHLTAKTPTKRVRIGKTLPSEKAVVTEPAKG EEAFQMSEVDEESGLKDSEPERKRKKTEDSSSGKS VASDVPEELDFLVPKAGFFCPICSLFYSGEKAMTN HCKSTRHKQNTEKFMAKQRKEKEQNEAEERSSR |
Expression Region |
1701-1978aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
47.2 kDa |
Alternative Name(s) |
Cutaneous T-cell lymphoma-associated antigen se33-1 Short name:CTCL-associated antigen se33-1 Nuclear protein 220 Zinc finger matrin-like protein |
Relevance |
Early regulator of adipogenesis that works as a transcription cofactor of CEBPs, controlling the expression of PPARG and probably of other proadipogenic genes, such as SREBF1 (By similarity). Binds to cytidine clusters in double-stranded DNA (PubMed:8647861). May also regulate alternative splicing of target genes during adipogenesis (By similarity). |
Reference |
A large DNA-binding nuclear protein with RNA recognition motif and serine/arginine-rich domain.Inagaki H., Matsushima Y., Nakamura K., Ohshima M., Kadowaki T., Kitagawa Y.J. Biol. Chem. 271:12525-12531(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Early regulator of adipogenesis that works as a transcription cofactor of CEBPs, controlling the expression of PPARG and probably of other proadipogenic genes, such as SREBF1 (By similarity). Binds to cytidine clusters in double-stranded DNA |
Subcellular Location |
Nucleus speckle |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.