« Zurück
Home /
Recombinant Human Zinc finger protein 160(ZNF160)

Recombinant Human Zinc finger protein 160(ZNF160)

ArtNr	CSB-EP026549HU-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Zinc finger protein HZF5,Zinc finger protein Kr18,Short name:,HKr18
Lieferbar
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q9HCG1
Gene Names	ZNF160
Organism	Homo sapiens (Human)
AA Sequence	MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRD VMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVK SCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGI CCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCD KRVGSIF
Expression Region	1-147aa
Sequence Info	Full Length of Isoform 2
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	22.1 kDa
Alternative Name(s)	Zinc finger protein HZF5 Zinc finger protein Kr18 Short name: HKr18
Relevance	May be involved in transcriptional regulation.
Reference	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in transcriptional regulation.
Subcellular Location	Nucleus
Protein Families	Krueppel C2H2-type zinc-finger protein family
Tissue Specificity	Ubiquitous.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen