« Zurück
Home /
Recombinant Human UDP-glucuronosyltransferase 1A4(UGT1A4)

Recombinant Human UDP-glucuronosyltransferase 1A4(UGT1A4)

ArtNr	CSB-EP025577HU-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	UDPGT 1-4,Short name:,UGT1*4,Short name:,UGT1-04,Short name:,UGT1.4,Alternative name(s):,Bilirubin-specific UDPGT isozyme 2,Short name:,hUG-BR2,UDP-glucuronosyltransferase 1-D,Short name:,UGT-1D,Short name:,UGT1D,UDP-glucuronosyltransferase 1A4
Lieferbar
Research Areas	Signal Transduction
Uniprot ID	P22310
Gene Names	UGT1A4
Organism	Homo sapiens (Human)
AA Sequence	GKVLVVPTDGSPWLSMREALRELHARGHQAVVLTP EVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQ GFFETEHLLKRYSRSMAIMNNVSLALHRCCVELLH NEALIRHLNATSFDVVLTDPVNLCGAVLAKYLSIP AVFFWRYIPCDLDFKGTQCPNPSSYIPKLLTTNSD HMTFLQRVKNMLYPLALSYICHTFSAPYASLASEL FQREVSVVDLVSYASVWLFRGDFVMDYPRPIMPNM VFIGGINCANGKPLSQEFEAYINASGEHGIVVFSL GSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRP SNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHG VYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVT LNVLEMTSEDLENALKAVINDKSYKENIMRLSSLH KDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLT WYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKC LGKKGRVKKAHKSKTH
Expression Region	29-534aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	61 kDa
Alternative Name(s)	UDPGT 1-4 Short name: UGT1*4 Short name: UGT1-04 Short name: UGT1.4 Alternative name(s): Bilirubin-specific UDPGT isozyme 2 Short name: hUG-BR2 UDP-glucuronosyltransferase 1-D Short name: UGT-1D Short name: UGT1D UDP-glucuronosyltransferase 1A4
Relevance	UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform glucuronidates bilirubin IX-alpha to form both the IX-alpha-C8 and IX-alpha-C12 monoconjugates and diconjugate. Isoform 2 lacks transferase activity but acts as a negative regulator of isoform 1 (By similarity).
Reference	Molecular pathogenesis of Gilbert's syndrome: decreased TATA-binding protein binding affinity of UGT1A1 gene promoter.Hsieh T.Y., Shiu T.Y., Huang S.M., Lin H.H., Lee T.C., Chen P.J., Chu H.C., Chang W.K., Jeng K.S., Lai M.M., Chao Y.C.Pharmacogenet. Genomics 17:229-236(2007) .
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform glucuronidates bilirubin IX-alpha to form both the IX-alpha-C8 and IX-alpha-C12 monoconjugates and diconjugate. Isoform 2 lacks transferase activity but acts as a negative regulator of isoform 1 (By similarity).
Involvement in disease	Gilbert syndrome (GILBS); Crigler-Najjar syndrome 1 (CN1); Crigler-Najjar syndrome 2 (CN2)
Subcellular Location	Microsome, Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families	UDP-glycosyltransferase family
Tissue Specificity	Isoform 1 and isoform 2 are expressed in liver, kidney, colon and small intestine. Isoform 2 but not isoform 1 is expressed in esophagus. Not expressed in skin.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen