« Zurück
Home /
Recombinant Mouse Thrombospondin-1(Thbs1)?partial

Recombinant Mouse Thrombospondin-1(Thbs1)?partial

Hersteller	Cusabio
Kategorie	Neuroscience Neuroinflammation Molecular Targets for Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP023487MO-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Purity	Greater than 90% as determined by SDS-PAGE.
Research areas	Others
Target / Protein	Thbs1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	Q80YQ1
AA Sequence	NRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQD LSSPAFRIENANLIPAVPDDKFQDLLDAVWADKGF IFLASLRQMKKTRGTLLAVERKDNTGQIFSVVSNG KAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITL FVQEDRAQLYIDCDKMESAELDVPIQSIFTRDLAS VARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILR NKGCSSSATNVLLTLDNNVVNGSSPAIRTNYIGHK TKDLQAICGLSCDELSSMVLELKGLRTIVTTLQDS IRKVTEENRELVSELKRPPLCFHNGVQYKNNEEWT VDSCTECHCQNSVTICK
Tag Info	N-terminal 6xHis-tagged
Expression Region	19-350aa
Protein length	Full Length of Mature Protein
MW	40.6 kDa
Relevance	Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Binds heparin. May play a role in dentinogenesis and/or maintenance of dentin and dental pulp. Ligand for CD36 mediating antiangiogenic properties . Plays a role in ER stress response, via its interaction with the activating transcription factor 6 alpha (ATF6) which produces adaptive ER stress response factors.1 Publication
References	A thrombospondin-dependent pathway for a protective ER stress response.Lynch J.M., Maillet M., Vanhoutte D., Schloemer A., Sargent M.A., Blair N.S., Lynch K.A., Okada T., Aronow B.J., Osinska H., Prywes R., Lorenz J.N., Mori K., Lawler J., Robbins J., Molkentin J.D.Cell 149:1257-1268(2012)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP023487MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen