ArtNr |
CSB-EP023317HU-50 |
Hersteller |
Cusabio
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Haptocorrin,Short name:,HC,Protein R,Transcobalamin I,Short name:,TC I,Short name:,TCI |
Lieferbar |
|
Research areas |
Signal Transduction |
Target / Protein |
TCN1 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P20061 |
AA Sequence |
EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVV LSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSG ELALIILALGVCRNAEENLIYDYHLIDKLENKFQA EIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYST AEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCV KKSLINGQIKADEGSLKNISIYTKSLVEKILSEKK ENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQT LNTVLTEISQGAFSNPNAAAQVLPALMGKTFLDIN KDSSCVSASGNFNISADEPITVTPPDSQSYISVNY SVRINETYFTNVTVLNGSVFLSVMEKAQKMNDTIF GFTMEERSWGPYITCIQGLCANNNDRTYWELLSGG EPLSQGAGSYVVRNGENLEVRWSKY |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
24-433aa |
Protein length |
Full Length of Mature Protein |
MW |
61.6 kDa |
Alternative Name(s) |
Haptocorrin Short name: HC Protein R Transcobalamin I Short name: TC I Short name: TCI |
Relevance |
Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach. |
References |
"Structural basis for universal corrinoid recognition by the cobalamin transport protein haptocorrin."Furger E., Frei D.C., Schibli R., Fischer E., Prota A.E.J. Biol. Chem. 288:25466-25476(2013) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach. |
Subcellular Location |
Secreted |
Protein Families |
Eukaryotic cobalamin transport proteins family |
Tissue Specificity |
Produced by the salivary glands of the oral cavity, in response to ingestion of food. Major constituent of secondary granules in neutrophils. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.