« Zurück
Home /
Recombinant Human Signal-regulatory protein gamma(SIRPG),partial

Recombinant Human Signal-regulatory protein gamma(SIRPG),partial

ArtNr	CSB-EP021338HU-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD172 antigen-like family member B,Signal-regulatory protein beta-2,Short name:,SIRP-b2,Short name:,SIRP-beta-2,CD_antigen: CD172g
Lieferbar
Research Areas	Immunology
Uniprot ID	Q9P1W8
Gene Names	SIRPG
Organism	Homo sapiens (Human)
AA Sequence	EEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGP VLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRN NMDFSIRISSITPADVGTYYCVKFRKGSPENVEFK SGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTC ESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSV AYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPL RGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQV RKFYPQSLQLTWSENGNVCQRETASTLTENKDGTY NWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRL ALEVTVHQKDQSSDATP
Expression Region	29-360aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	40.8 kDa
Alternative Name(s)	CD172 antigen-like family member B Signal-regulatory protein beta-2 Short name: SIRP-b2 Short name: SIRP-beta-2 CD_antigen: CD172g
Relevance	Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation.
Reference	Molecular cloning of a novel human gene (SIRP-B2) which encodes a new member of the SIRP/SHPS-1 protein family.Ichigotani Y., Matsuda S., Machida K., Oshima K., Iwamoto T., Yamaki K., Hayakawa T., Hamaguchi M.J. Hum. Genet. 45:378-382(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation.
Subcellular Location	Membrane, Single-pass type I membrane protein
Tissue Specificity	Detected in liver, and at very low levels in brain, heart, lung, pancreas, kidney, placenta and skeletal muscle. Expressed on CD4+ T-cells, CD8+ T-cells, CD56-bright natural killer (NK) cells, CD20+ cells, and all activated NK cells. Mainly present in the paracortical T-cell area of lymph nodes, with only sparse positive cells in the mantle and in the germinal center of B-cell follicles. In the thymus, primarily expressed in the medulla on mature T-lymphocytes that have undergone thymic selection.
Paythway	Osteoclastdifferentiation
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP021338HU-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen