ArtNr |
CSB-EP021335HU-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Signal-regulatory protein beta-1,Short name:SIRP-beta-1,Alternative name(s):,CD172 antigen-like family member B,CD_antigen: CD172b |
Lieferbar |
|
Research Topic |
Signal transduction |
Uniprot ID |
O00241 |
Gene Names |
SIRPB1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
EDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGP IMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRN NLDFSISISNITPADAGTYYCVKFRKGSPDDVEFK SGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTC ESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSV SYSIHSTARVVLTRGDVHSQVICEIAHITLQGDPL RGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQV SNFYPRGLQLTWLENGNVSRTETASTLIENKDGTY NWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSY ALEISAHQKEHGSDITHEAALAPTAPL |
Expression Region |
30-371aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
41.3 kDa |
Alternative Name(s) |
Signal-regulatory protein beta-1 Short name:SIRP-beta-1 Alternative name(s): CD172 antigen-like family member B CD_antigen: CD172b |
Relevance |
Immunoglobulin-like cell surface receptor involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Participates also in the recruitment of tyrosine kinase SYK. |
Reference |
"Paired receptor specificity explained by structures of signal regulatory proteins alone and complexed with CD47."Hatherley D., Graham S.C., Turner J., Harlos K., Stuart D.I., Barclay A.N.Mol. Cell 31:266-277(2008) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Immunoglobulin-like cell surface receptor involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Participates also in the recruitment of tyrosine kinase SYK. |
Subcellular Location |
Membrane, Single-pass type I membrane protein |
Tissue Specificity |
Detected in monocytes and dendritic cells. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.