« Zurück
Home /
Recombinant Bovine Pulmonary surfactant-associated protein B(SFTPB),partial

Recombinant Bovine Pulmonary surfactant-associated protein B(SFTPB),partial

ArtNr	CSB-EP021173BO1-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Cell Biology
Uniprot ID	P15781
Gene Names	SFTPB
Organism	Bos taurus (Bovine)
AA Sequence	AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQE VWGHVEADDLCQECENISRLLTKMAKEAIFQDSVR KFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQ SHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDK LALPLLPGVPQAKPGPQTQDLSEQL
Expression Region	23-187aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	23.5 kDa
Alternative Name(s)	6KDA protein Pulmonary surfactant-associated proteolipid SPL(Phe)
Relevance	Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Reference	"Characterization of the small hydrophobic proteins associated with pulmonary surfactant." Yu S.-H., Chung W., Olafson R.W., Harding P.G.R., Possmayer F. Biochim. Biophys. Acta 921:437-448(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Subcellular Location	Secreted, extracellular space, surface film
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen