« Zurück
Home /
Recombinant Mouse S-arrestin(Sag)

Recombinant Mouse S-arrestin(Sag)

ArtNr	CSB-EP020669MOa0-50
Hersteller	Cusabio
Menge	50ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P20443
Gene Names	Sag
Organism	Mus musculus (Mouse)
AA Sequence	MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDH VSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQ EDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQ ESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDV GKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLI RKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSL SKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQI ANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLV LVPLLANNRERRGIALDGKIKHEDTNLASSTIIKE GIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVAT EVPFRLMHPQPEDPAKESVQDENLVFEEFARQNLK DTGENTEGKKDEDAGQDE
Expression Region	1-403aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	50.4 kDa
Alternative Name(s)	48 kDa protein (Retinal S-antigen) (S-AG) (Rod photoreceptor arrestin)
Relevance	Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO. May play a role in preventing light-dependent degeneration of retinal photoreceptor cells
Reference	"Deactivation of phosphorylated and nonphosphorylated rhodopsin by arrestin splice variants." Burns M.E., Mendez A., Chen C.K., Almuete A., Quillinan N., Simon M.I., Baylor D.A., Chen J. J. Neurosci. 26:1036-1044(2006)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO
Subcellular Location	Cell projection, cilium, photoreceptor outer segment, Membrane, Peripheral membrane protein
Protein Families	Arrestin family
Tissue Specificity	Detected in retina (at protein level).
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen