« Zurück
Home /
Recombinant Horse Serum amyloid A protein(SAA1)

Recombinant Horse Serum amyloid A protein(SAA1)

ArtNr	CSB-EP020656HOb0-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Cardiovascular
Target / Protein	SAA1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Equus caballus (Horse)
Uniprot ID	P19857
AA Sequence	LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFH ARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRF SFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHG LPDKY
Tag Info	N-terminal 10xHis-tagged
Expression Region	1-110aa
Protein length	Full Length
MW	15.8 kDa
Alternative Name(s)	Amyloid fibril protein AA
Relevance	Major acute phase reactant. Apolipoprotein of the HDL complex.
References	The amino acid sequence of an amyloid fibril protein AA isolated from the horse.Sletten K., Husebekk A., Husby G.Scand. J. Immunol. 26:79-84(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Major acute phase reactant. Apolipoprotein of the HDL complex.
Involvement in disease	Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.
Protein Families	SAA family
Tissue Specificity	Expressed by the liver; secreted in plasma.
Tag Information	N-terminal 10xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen