ArtNr |
CSB-EP020595HU-100 |
Hersteller |
Cusabio
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Konjugat/Tag |
Myc |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Acute myeloid leukemia 2 protein,Core-binding factor subunit alpha-3,Short name:CBF-alpha-3 |
Lieferbar |
|
Research Areas |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q13761 |
Gene Names |
RUNX3 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGA LSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTD SPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGT VVTVMAGNDENYSAELRNASAVMKNQVARFNDLRF VGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVD GPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTP STPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDP RQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPY SATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGA PQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSS SGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQS DGVEADGSHSNSPTALSTPGRMDEAVWRPY |
Expression Region |
1-415aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
MW |
49.4 kDa |
Alternative Name(s) |
Acute myeloid leukemia 2 protein Core-binding factor subunit alpha-3 Short name:CBF-alpha-3 |
Relevance |
CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, lck, IL-3 and GM-CSF promoters. In association with ZFHX3, upregulates CDKN1A promoter activity following TGF-beta stimulation (PubMed:20599712). |
Reference |
AML1, AML2, and AML3, the human members of the runt domain gene-family: cDNA structure, expression, and chromosomal localization.Levanon D., Negreanu V., Bernstein Y., Bar-Am I., Avivi L., Groner Y.Genomics 23:425-432(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, lck, IL-3 and GM-CSF promoters. In association with ZFHX3, upregulates CDKN1A promoter activity following TGF-beta stimulation |
Subcellular Location |
Nucleus, Cytoplasm |
Tissue Specificity |
Expressed in gastric cancer tissues (at protein level). |
Paythway |
Th1andTh2celldifferentiation |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.